PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0520s0090.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 252aa    MW: 26045 Da    PI: 7.1527
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0520s0090.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof1214.1e-383292262
                  zf-Dof  2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62
                             +++l+cprCdstntkfCyynny+ sqPr+fCk+CrryWt+GG+lr++P+Ggg+r+n k+s
  SapurV1A.0520s0090.1.p 32 DQEHLPCPRCDSTNTKFCYYNNYNFSQPRHFCKSCRRYWTHGGTLRDIPIGGGTRRNAKRS 92
                            57899***************************************************98876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-243284IPR003851Zinc finger, Dof-type
PfamPF027018.0E-333490IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.1433690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 252 aa     Download sequence    Send to blast
MPTELSSCET TRRPPLSAAP TLTKPEGAPP QDQEHLPCPR CDSTNTKFCY YNNYNFSQPR  60
HFCKSCRRYW THGGTLRDIP IGGGTRRNAK RSRTSASTAA SFVGPENNID DLPLHSTPVL  120
VPLTASQGFP VHFGGGGDGK GSGGCGSGAL GGSFTSLLSA PGPAGILTLG RFGHGLGHGL  180
EDMECGLGRG LWSFPGIGDG GAGVGGHVGV SVTAGLDSTW QFESGPENCF SAGDCFSWPE  240
LAISTPANGF K*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002306448.11e-130hypothetical protein POPTR_0005s13990g
SwissprotQ390887e-58DOF34_ARATH; Dof zinc finger protein DOF3.4
TrEMBLB9H6B81e-130B9H6B8_POPTR; Uncharacterized protein
STRINGPOPTR_0005s13990.11e-129(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF28013168
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.16e-43OBF binding protein 1